PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054745.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 262aa    MW: 30105.4 Da    PI: 10.165
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054745.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.6e-26959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  kri++++ rqvtfskRr+g++KKA ELS+LCdaev +i+fs tgkly+++s
  EcC054745.10  9 KRIDDSTSRQVTFSKRRKGLIKKARELSILCDAEVGLIVFSCTGKLYDFAS 59
                  79***********************************************86 PP

2K-box707.6e-24821551083
         K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                    +++ +++q+e+a L+++++ Lq+ +R+l Ge+L+ L +k+Lq+Le+qLe slk i +kK +++ +qi+el  k
  EcC054745.10  82 PASEIKHCQREVASLRQQLQHLQERHRQLTGEQLSGLRVKDLQNLENQLEMSLKGIHAKKVQIFSDQIKELNLK 155
                   567899****************************************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
CDDcd002651.48E-43277No hitNo description
SuperFamilySSF554551.57E-31283IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2185155IPR002487Transcription factor, K-box
PROSITE profilePS5129714.07286207IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRGKIVIKR IDDSTSRQVT FSKRRKGLIK KARELSILCD AEVGLIVFSC TGKLYDFASS  60
SMQSVLERYK EFRGEGHELH NPASEIKHCQ REVASLRQQL QHLQERHRQL TGEQLSGLRV  120
KDLQNLENQL EMSLKGIHAK KVQIFSDQIK ELNLKVFTKL TPSFQWYGHR LSSDSHKLNS  180
FQGNMLHEEN KELHRKTSLL LQENNALRTK VYKARDVNHA KLYFHEPATT TIVHDLFAPS  240
NLQLSQPQPQ SKEAPLEATN LG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-21278176Myocyte-specific enhancer factor 2A
3kov_B4e-21278176Myocyte-specific enhancer factor 2A
3kov_I4e-21278176Myocyte-specific enhancer factor 2A
3kov_J4e-21278176Myocyte-specific enhancer factor 2A
3p57_A4e-21278176Myocyte-specific enhancer factor 2A
3p57_B4e-21278176Myocyte-specific enhancer factor 2A
3p57_C4e-21278176Myocyte-specific enhancer factor 2A
3p57_D4e-21278176Myocyte-specific enhancer factor 2A
3p57_I4e-21278176Myocyte-specific enhancer factor 2A
3p57_J4e-21278176Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010068314.11e-167PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9SZJ61e-75AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLB9RX628e-98B9RX62_RICCO; Mads box protein, putative
STRINGVIT_18s0001g07900.t012e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-65AGAMOUS-like 21